AdTechTalent
Product15 days agoOn-site

AppsFlyer

Senior Product Manager - Attribution

product managementbig dataSaaSAPIsdata pipelinesalgorithmic logicmobile marketingadvertisingprivacyregulatory complianceAIdigital marketingattribution

Key details

Salary

Not specified

Employment type

Full-time

Seniority

Senior

Years experience

5-10

Location

Herzliya, Israel

Full job description

AppsFlyer seeks a Senior Product Manager for its Attribution product team. The role involves managing the product lifecycle of attribution algorithms and APIs critical to marketing analytics. Candidates must have 5+ years in product management of complex B2B SaaS platforms, strong technical knowledge of big data, APIs, data pipelines, and algorithmic logic. Responsibilities include driving product strategy in a privacy-first environment, collaborating with engineering and data teams, engaging with top clients for feedback, and aligning with executive leadership and strategic partners. Experience in mobile marketing and advertising is a plus.

What you'll do

  • Manage the product lifecycle of the attribution domain from discovery and definition through to execution, go-to-market (GTM), KPI measurement, and continuous optimization
  • Advance digital marketing measurement addressing shifts driven by AI, conversational search, and changing media consumption patterns
  • Lead product strategy in a privacy-first environment ensuring compliance with global regulatory changes and data restrictions
  • Collaborate closely with engineering teams, architects, and data analysts to deliver robust and scalable solutions
  • Partner directly with top clients to gather feedback and translate insights into impactful product capabilities
  • Drive high-visibility projects communicating progress and strategic vision with executive leadership
  • Foster alignment across internal Business, Marketing, and R&D teams and manage relationships with key strategic partners

Requirements

  • 5+ years of Product Management ownership in complex, high-scale B2B SaaS environments
  • Deep technical knowledge of big data architecture, APIs, data pipelines, and algorithmic logic
  • Ability to distill noisy market feedback into a crisp, data-backed product strategy
  • Team player with a sense of full ownership

Tech stack

Big DataAPIsSaaSdata pipelinesalgorithmic logic

Apply now

Ready to take the next step in your career? Click the button below to continue to the application process.

Continue to applicationBrowse more jobs

Similar jobs

More roles worth a look

Related opportunities based on specialty and working model so candidates can keep momentum.