AdTechTalent
Engineering26 days agoHybrid

Epsilon

Senior Software Engineer

pythondjangodjango rest frameworkcelerytypescriptreactawsterraformdockermicroservicesrest apipostgresqlredisopenshiftfastapimcpagentic aigenerative aillmragci/cddevopsoktajwtgraphqlreact nativeexpographqlgraphqlgraphql

Key details

Salary

Not specified

Employment type

Full-time

Seniority

Senior

Years experience

5-10

Location

Bengaluru, India

Full job description

Epsilon is seeking a Senior Software Engineer for the Agentic Platform team in Bengaluru, India. The role involves designing, developing, and delivering scalable cloud-native agent platform systems primarily on AWS. Key technologies include Python, Django, TypeScript, React, FastAPI, Celery, PostgreSQL, Redis, OpenSearch, AWS services, Terraform, and Docker. Responsibilities include building agent runtime services, enhancing product UIs, implementing MCP capabilities, optimizing performance, and collaborating with global teams. Candidates should have 5-7 years of experience in scalable application development, strong skills in Python/Django and TypeScript/React, experience with AWS cloud infrastructure, asynchronous processing, authentication protocols, Infrastructure as Code, CI/CD pipelines, and testing strategies. Familiarity with Generative AI, LLMs, agent orchestration, and related AI technologies is preferred. The company values employee well-being, collaboration, growth, innovation, flexibility, and diversity.

What you'll do

  • Build and deliver large-scale cloud-native agent platform capabilities primarily on AWS
  • Work hands-on across the technology stack including Python, Django, TypeScript, React, FastAPI, Celery, PostgreSQL, Redis, OpenSearch, AWS Bedrock, Strands Agent SDK, MCP, Terraform, and Docker
  • Design, develop, and operate agent runtime services including spec compilation, pre-flight authorization, skills seeding, MCP tool orchestration, streaming responses, and run package recording
  • Build and enhance agent builder and product UIs using React 19, shadcn/ui, TanStack Query, and type-safe OpenAPI client generation
  • Implement MCP catalog, gateway, and federation capabilities; integrate domain MCP servers for loyalty, customer CDP, messaging, digital media, and related enterprise systems
  • Drive performance optimization, scalability, reliability, security, tenant isolation, governance, and cost efficiency
  • Collaborate closely with global engineering, product management, architecture, AI/ML, and business partners
  • Own the end-to-end software development lifecycle including requirements gathering, solution design, development, deployment, observability, and documentation
  • Contribute to observability and quality through OpenTelemetry instrumentation, Grafana/Phoenix tracing, pytest/Vitest/Playwright testing, and CI/CD pipelines
  • Mentor engineers, lead technical design reviews, set engineering standards, and drive cross-team initiatives at senior levels

Requirements

  • Bachelor’s or Master’s degree in Computer Science, Information Technology, or related discipline
  • 5–7 years experience as a Senior Software Engineer
  • Proficiency in developing scalable applications and distributed systems
  • Extensive hands-on experience in Python and Django including Django REST Framework and/or Django Ninja
  • Advanced skills in TypeScript and React
  • Experience designing and constructing scalable REST APIs, microservices, containerized workloads, and distributed systems
  • Competence with PostgreSQL, Redis, and search/indexing systems
  • Experience with AWS services including ECS Fargate, RDS, S3, SQS, ALB, CloudFront, Secrets Manager, IAM, and AWS Bedrock
  • Expertise in asynchronous processing using Celery and message queues
  • Knowledge of SSE/WebSocket streaming for real-time solutions
  • Experience implementing authentication and authorization protocols using Okta/OIDC, JWT, and claims-based access control
  • Practical experience with Infrastructure as Code tools such as Terraform and/or AWS CDK
  • Understanding of CI/CD and DevOps methodologies
  • Ability to establish comprehensive testing strategies (unit, integration, end-to-end)
  • Excellent critical thinking and analytical capabilities
  • Awareness and exposure to Generative AI technologies including LLMs, RAG architectures, MCP, agent orchestration, and Agentic AI systems
  • Hands-on experience with agent runtime frameworks and AI platforms preferred

Tech stack

PythonDjangoDjango REST FrameworkDjango NinjaCeleryTypeScriptReact 19Vitepnpmshadcn/uiRadix UITailwind CSSPostgreSQLpgvectorRedisOpenSearchDocumentDBNeo4jMongoDBAWS ECS FargateAWS RDSAWS S3AWS SQSAWS ALBAWS CloudFrontAWS Secrets ManagerAWS IAMAWS BedrockTerraformAWS CDKDockerGoCDCodeDeployECRGitHubGitLabpytestVitestPlaywrightOpenTelemetryGrafanaPhoenixOktaOIDCJWTFastAPIStrands Agent SDKMCPFastMCPReact FlowCodeMirrorExpoReact NativeStep FunctionsEventBridgeHuskyOrvalLangfuseArize PhoenixLiteLLMDeepEvalGuardrails AITrinoDatabricksVertex AI

Benefits

Opportunities for growth through learning, development and career advancementFocus on employee well-beingCollaborative work environmentFlexibility balancing work and personal lifeInclusive and diverse workplaceInnovative and forward-thinking culture

Apply now

Ready to take the next step in your career? Click the button below to continue to the application process.

Similar jobs

More roles worth a look

Related opportunities based on specialty and working model so candidates can keep momentum.