Product Manager (App Monetization Solutions) at Aditude | AdTechTalent
Product3 months agoRemote
Aditude
Product Manager (App Monetization Solutions)
product managementmobilein-appad techmobile monetizationSDKSQLPrebid MobileOpenRTBgamingproduct-led growthself-serviceanalyticsprivacy frameworksSKANATTTCFGoogle Ad Manager
Key details
Salary
Not specified
Employment type
Full-time
Seniority
Senior
Years experience
5-10
Location
Worldwide
Full job description
Aditude is hiring a senior Product Manager to own the mobile in-app product line focused on mobile app monetization. This full-time remote role requires 5+ years of product management experience in ad tech, especially with mobile app ad products and mobile gaming publishers. Responsibilities include owning product vision, strategy, roadmap, KPIs, go-to-market, and outcomes. The candidate must be highly technical, proficient in SDK architectures, mobile ad ecosystem (mediation, bidding, SDKs, privacy frameworks), and data analysis (SQL, analytics tools). The role demands cross-functional collaboration with Engineering, Ad Ops, Sales, and Design, direct engagement with publishers, and building scalable products. Preferred experience includes Prebid Mobile, open-source bidding, gaming studios, ad networks, SSPs, Google Ad Manager, and product-led growth strategies. Benefits include medical, dental, vision insurance, unlimited time off, holidays, remote-first culture, and career growth opportunities.
What you'll do
Own the Mobile In-App Product: product vision, strategy, and roadmap from SDK to reporting
Similar jobs
More roles worth a look
Related opportunities based on specialty and working model so candidates can keep momentum.
Drive Product KPIs: define, track, and be accountable for adoption, revenue impact, SDK performance, and publisher satisfaction
Go to Market: lead product launches including positioning, messaging, enablement, working with Sales and Marketing
Be Deeply Technical: understand mobile ad ecosystem including mediation, bidding, waterfall vs unified auctions, SDK integration, SKAN, privacy frameworks
Live in the Data: use quantitative analysis to inform decisions, validate hypotheses, and prioritize based on impact
Partner Cross-Functionally: collaborate with Engineering, Ad Ops, and Design to translate publisher needs into shippable solutions
Engage Directly with Publishers: conduct customer research, gather feedback, build relationships especially with mobile gaming publishers
Build for Scale: design products and processes for automation, self-service, and operational efficiency
Requirements
5+ years of product management experience in ad tech, specifically with products that serve ads in mobile apps
Proven experience working with mobile gaming publishers or gaming ad networks/SDKs
Deep understanding of the mobile advertising ecosystem: mediation platforms, in-app bidding, ad SDKs (AppLovin, ironSource, Unity, AdMob, etc.), OpenRTB, and privacy frameworks (ATT, SKAN, TCF)
Track record of taking products to market and owning outcomes end-to-end
Highly technical—comfortable reading documentation, understanding SDK architectures, and speaking fluently with engineers
Strong data analysis skills; comfortable in SQL, analytics tools, and making decisions backed by numbers
Experience defining and tracking product metrics and KPIs
Excellent communicator able to translate complex technical concepts for any audience and rally teams around a vision
Exceptionally organized, able to juggle competing priorities and keep cross-functional teams aligned
Scrappy and relentless, willing to do whatever it takes to make the product succeed
Comfortable with ambiguity and energized by building in a fast-moving environment
Experience with Prebid Mobile or open-source bidding solutions
Background working at a mobile gaming studio, ad network, SSP, or SDK provider
Familiarity with publisher ad ops workflows and Google Ad Manager
Experience with product-led growth strategies and self-service product design
Bachelor's degree in Computer Science, Engineering, Business, or related field (or equivalent experience)
Tech stack
SDKSQLPrebid MobileOpenRTBAppLovinironSourceUnityAdMobGoogle Ad ManagerSKANATTTCF
Benefits
Impact: work directly influences publisher revenue and shapes product roadmapOwnership: trusted to own domain and make decisionsGrowth: scaling company with career paths as launchpadsCulture: builders, problem-solvers, ad tech nerds with high expectationsFlexibility: remote-first environment with autonomy100% remote with a global footprintMedical, Dental, and Vision InsuranceUnlimited Time Off + 11 Holidays + Christmas week to rechargeOpportunity to join a fast-growing technology company
Apply now
Ready to take the next step in your career? Click the button below to continue to the application process.
